LEMD2 Antikörper (Middle Region)

Produktnummer ABIN634879

Produktdetails anti-LEMD2 Antikörper

Target: LEMD2 (LEM Domain Containing 2 (LEMD2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LEMD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LEMD2 antibody was raised against the middle region of LEMD2

Aufreinigung: Affinity purified

Immunogen: LEMD2 antibody was raised using the middle region of LEMD2 corresponding to a region with amino acids QDMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESH

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LEMD2 Blocking Peptide, catalog no. 33R-7506, is also available for use as a blocking control in assays to test for specificity of this LEMD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEMD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LEMD2

Target: LEMD2 (LEM Domain Containing 2 (LEMD2))

Andere Bezeichnung: LEMD2 (LEMD2 Produkte)

Synonyme: NET25 antikoerper, dJ482C21.1 antikoerper, BC026588 antikoerper, Lem2 antikoerper, LEM domain containing 2 antikoerper, LEMD2 antikoerper, Lemd2 antikoerper

Hintergrund: LEMD2 is involved in nuclear structure organization.

Molekulargewicht: 57 kDa (MW of target protein)