LEMD2 Antikörper (Middle Region)
-
- Target Alle LEMD2 Antikörper anzeigen
- LEMD2 (LEM Domain Containing 2 (LEMD2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LEMD2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LEMD2 antibody was raised against the middle region of LEMD2
- Aufreinigung
- Affinity purified
- Immunogen
- LEMD2 antibody was raised using the middle region of LEMD2 corresponding to a region with amino acids QDMERYPYVGILHVRDSLIPPQSRRRMKRVWDRAVEFLASNESRIQTESH
- Top Product
- Discover our top product LEMD2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LEMD2 Blocking Peptide, catalog no. 33R-7506, is also available for use as a blocking control in assays to test for specificity of this LEMD2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LEMD2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LEMD2 (LEM Domain Containing 2 (LEMD2))
- Andere Bezeichnung
- LEMD2 (LEMD2 Produkte)
- Synonyme
- NET25 antikoerper, dJ482C21.1 antikoerper, BC026588 antikoerper, Lem2 antikoerper, LEM domain containing 2 antikoerper, LEMD2 antikoerper, Lemd2 antikoerper
- Hintergrund
- LEMD2 is involved in nuclear structure organization.
- Molekulargewicht
- 57 kDa (MW of target protein)
-