SLC26A1 Antikörper

Produktnummer ABIN634881

Produktdetails anti-SLC26A1 Antikörper

Target: SLC26A1 (Solute Carrier Family 26 (Sulfate Transporter), Member 1 (SLC26A1))

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC26A1 Antikörper ist unkonjugiert

Applikation: Immunohistochemistry (IHC), Western Blotting (WB)

Aufreinigung: Affinity purified

Immunogen: SLC26 A1 antibody was raised using a synthetic peptide corresponding to a region with amino acids LYSLTGLDAGCMAARRKEGGSETGVGEGGPAQGEDLGPVSTRAALVPAAA

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC26A1 Blocking Peptide, catalog no. 33R-5575, is also available for use as a blocking control in assays to test for specificity of this SLC26A1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC26A1

Target: SLC26A1 (Solute Carrier Family 26 (Sulfate Transporter), Member 1 (SLC26A1))

Andere Bezeichnung: SLC26A1 (SLC26A1 Produkte)

Synonyme: edm4 antikoerper, sat1 antikoerper, sat-1 antikoerper, MGC86347 antikoerper, SLC26A1 antikoerper, sb:cb565 antikoerper, wu:fe23c03 antikoerper, zgc:158435 antikoerper, EDM4 antikoerper, SAT-1 antikoerper, SAT1 antikoerper, Sat1 antikoerper, solute carrier family 26 (anion exchanger), member 1 L homeolog antikoerper, solute carrier family 26 member 1 antikoerper, solute carrier family 26 (anion exchanger), member 1 antikoerper, solute carrier family 26 (sulfate transporter), member 1 antikoerper, slc26a1.L antikoerper, SLC26A1 antikoerper, slc26a1 antikoerper, Slc26a1 antikoerper

Hintergrund: SLC26A1 is a member of sulfate/anion transporter family. Family members are well conserved in their protein (aa length among species) structures, but have markedly different tissue expression patterns. Its gene is primarily expressed in the liver, pancreas, and brain.

Molekulargewicht: 77 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process, Ribonucleoside Biosynthetic Process, Dicarboxylic Acid Transport