GRAMD2 Antikörper (Middle Region)

Produktnummer ABIN634882

Produktdetails anti-GRAMD2 Antikörper

Target: GRAMD2 (GRAM Domain Containing 2 (GRAMD2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser GRAMD2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GRAMD2 antibody was raised against the middle region of GRAMD2

Aufreinigung: Affinity purified

Immunogen: GRAMD2 antibody was raised using the middle region of GRAMD2 corresponding to a region with amino acids LPNGLAITTNTSQKYIFVSLLSRDSVYDLLRRVCTHLQPSSKKSLSVREF

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GRAMD2 Blocking Peptide, catalog no. 33R-5276, is also available for use as a blocking control in assays to test for specificity of this GRAMD2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GRAMD2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu GRAMD2

Target: GRAMD2 (GRAM Domain Containing 2 (GRAMD2))

Andere Bezeichnung: GRAMD2 (GRAMD2 Produkte)

Synonyme: BC064463 antikoerper, RGD1564007 antikoerper, Gramd2 antikoerper, GRAM domain containing 2 antikoerper, GRAM domain containing 2A antikoerper, Gramd2 antikoerper, GRAMD2A antikoerper, Gramd2a antikoerper

Hintergrund: The function of GRAMD2 protein has not been widely studied, and is yet to be fully elucidated.

Molekulargewicht: 40 kDa (MW of target protein)