BAT5 Antikörper (Middle Region)
-
- Target Alle BAT5 (ABHD16A) Antikörper anzeigen
- BAT5 (ABHD16A) (Abhydrolase Domain Containing 16A (ABHD16A))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser BAT5 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- BAT5 antibody was raised against the middle region of BAT5
- Aufreinigung
- Affinity purified
- Immunogen
- BAT5 antibody was raised using the middle region of BAT5 corresponding to a region with amino acids RAKLLACDGNEIDTMFVDRRGTAEPQGQKLVICCEGNAGFYEVGCVSTPL
- Top Product
- Discover our top product ABHD16A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
BAT5 Blocking Peptide, catalog no. 33R-7812, is also available for use as a blocking control in assays to test for specificity of this BAT5 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of BAT5 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- BAT5 (ABHD16A) (Abhydrolase Domain Containing 16A (ABHD16A))
- Andere Bezeichnung
- BAT5 (ABHD16A Produkte)
- Synonyme
- BAT5 antikoerper, D6S82E antikoerper, NG26 antikoerper, PP199 antikoerper, AI326074 antikoerper, Bat-5 antikoerper, Bat5 antikoerper, D17H6S82E antikoerper, bat5 antikoerper, bat5l antikoerper, wu:fb55e01 antikoerper, bat5-b antikoerper, ng26 antikoerper, pp199 antikoerper, abhydrolase domain containing 16A antikoerper, abhydrolase domain containing 16A L homeolog antikoerper, ABHD16A antikoerper, Abhd16a antikoerper, abhd16a antikoerper, abhd16a.L antikoerper
- Hintergrund
- A cluster of genes, BAT1-BAT5, has been localized in the vicinity of the genes for TNF alpha and TNF beta. These genes are all within the human major histocompatibility complex class III region. BAT5 is thought to be involved in some aspects of immunity.
- Molekulargewicht
- 63 kDa (MW of target protein)
-