Plexin A2 Antikörper (N-Term)

Produktnummer ABIN634887

Produktdetails anti-Plexin A2 Antikörper

Target: Plexin A2 (Plxna2)

Bindungsspezifität: N-Term

Reaktivität: Human, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Plexin A2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Plexin A2 antibody was raised against the N terminal of PLXNA2

Aufreinigung: Affinity purified

Immunogen: Plexin A2 antibody was raised using the N terminal of PLXNA2 corresponding to a region with amino acids SVASYVYNGYSVVFVGTKSGKLKKIRADGPPHGGVQYEMVSVLKDGSPIL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Plexin A2 Blocking Peptide, catalog no. 33R-8901, is also available for use as a blocking control in assays to test for specificity of this Plexin A2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PLXNA2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Plexin A2

Target: Plexin A2 (Plxna2)

Andere Bezeichnung: Plexin A2 (Plxna2 Produkte)

Synonyme: oct antikoerper, plxn2 antikoerper, OCT antikoerper, PLXN2 antikoerper, 2810428A13Rik antikoerper, AA589422 antikoerper, AW457381 antikoerper, Plxn2 antikoerper, mKIAA0463 antikoerper, plexin A2 antikoerper, plexin-A2 antikoerper, PLXNA2 antikoerper, plxna2 antikoerper, LOC100078346 antikoerper, Plxna2 antikoerper

Hintergrund: PLXNA2 is a member of the plexin-A family of semaphorin co-receptors. Semaphorins are a large family of secreted or membrane-bound proteins that mediate repulsive effects on axon pathfinding during nervous system development. A subset of semaphorins are recognised by plexin-A/neuropilin transmembrane receptor complexes, triggering a cellular signal transduction cascade that leads to axon repulsion.

Molekulargewicht: 211 kDa (MW of target protein)