LAPTM4B Antikörper (Middle Region)
-
- Target Alle LAPTM4B Antikörper anzeigen
- LAPTM4B (Lysosomal Protein Transmembrane 4 beta (LAPTM4B))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LAPTM4B Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LAPTM4 B antibody was raised against the middle region of LAPTM4
- Aufreinigung
- Affinity purified
- Immunogen
- LAPTM4 B antibody was raised using the middle region of LAPTM4 corresponding to a region with amino acids YPNSIQEYIRQLPPNFPYRDDVMSVNPTCLVLIILLFISIILTFKGYLIS
- Top Product
- Discover our top product LAPTM4B Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LAPTM4B Blocking Peptide, catalog no. 33R-10204, is also available for use as a blocking control in assays to test for specificity of this LAPTM4B antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LAPTM0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LAPTM4B (Lysosomal Protein Transmembrane 4 beta (LAPTM4B))
- Andere Bezeichnung
- LAPTM4B (LAPTM4B Produkte)
- Synonyme
- LAPTM4beta antikoerper, LC27 antikoerper, C330023P13Rik antikoerper, lysosomal protein transmembrane 4 beta antikoerper, lysosomal-associated protein transmembrane 4B antikoerper, LAPTM4B antikoerper, Laptm4b antikoerper
- Hintergrund
- LAPTM4B is a multi-pass membrane protein. It belongs to the LAPTM4/LAPTM5 transporter family. LAPTM4b has active role in disease progression of malignant cells and is involved in cell proliferation and multidrug resistance. The genetic polymorphism of LAPTM4B is a potential risk factor for the development of colon cancer and gastric cancer. The research results also indicated that LAPTM4B may be a clinically useful prognostic indicator for ovarian carcinoma and may play a role in human hepatocellular carcinoma.
- Molekulargewicht
- 35 kDa (MW of target protein)
-