Tmc2 Antikörper (Middle Region)
-
- Target Alle Tmc2 Antikörper anzeigen
- Tmc2 (Transmembrane Channel-Like 2 (Tmc2))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Tmc2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TMC2 antibody was raised against the middle region of TMC2
- Aufreinigung
- Affinity purified
- Immunogen
- TMC2 antibody was raised using the middle region of TMC2 corresponding to a region with amino acids YCWCWDLEAGFPSYAEFDISGNVLGLIFNQGMIWMGSFYAPGLVGINVLR
- Top Product
- Discover our top product Tmc2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMC2 Blocking Peptide, catalog no. 33R-10062, is also available for use as a blocking control in assays to test for specificity of this TMC2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMC2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Tmc2 (Transmembrane Channel-Like 2 (Tmc2))
- Andere Bezeichnung
- TMC2 (Tmc2 Produkte)
- Hintergrund
- TMC2 is considered a member of transmembrane proteins family. The specific function of this gene is unknown, however, expression in the inner ear suggests that it may be crucial for normal auditory function. This gene is considered a member of a gene family predicted to encode transmembrane proteins.
- Molekulargewicht
- 102 kDa (MW of target protein)
-