ST8SIA6 Antikörper (Middle Region)

Produktnummer ABIN634897

Produktdetails anti-ST8SIA6 Antikörper

Target: ST8SIA6 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 6 (ST8SIA6))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ST8SIA6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: ST8 SIA6 antibody was raised against the middle region of ST8 IA6

Aufreinigung: Affinity purified

Immunogen: ST8 SIA6 antibody was raised using the middle region of ST8 IA6 corresponding to a region with amino acids LEESKARQKVLFFHPKYLKDLALFWRTKGVTAYRLSTGLMITSVAVELCK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ST8SIA6 Blocking Peptide, catalog no. 33R-4893, is also available for use as a blocking control in assays to test for specificity of this ST8SIA6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ST0 IA6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ST8SIA6

Target: ST8SIA6 (ST8 alpha-N-Acetyl-Neuraminide alpha-2,8-Sialyltransferase 6 (ST8SIA6))

Andere Bezeichnung: ST8SIA6 (ST8SIA6 Produkte)

Synonyme: Siat8f antikoerper, SIAT8F antikoerper, siat8F antikoerper, siat 8F antikoerper, wu:fa12f08 antikoerper, wu:fb95c11 antikoerper, SIA8F antikoerper, ST8SIA-VI antikoerper, 1700007J08Rik antikoerper, AI314453 antikoerper, AI875066 antikoerper, ST8SiaVI antikoerper, ST8 alpha-N-acetyl-neuraminide alpha-2,8-sialyltransferase 6 antikoerper, St8sia6 antikoerper, ST8SIA6 antikoerper, st8sia6 antikoerper, LOC592192 antikoerper

Hintergrund: Sialic acid is a key determinate of oligosaccharide structures involved in cell-cell communication, cell-substrate interaction, adhesion, and protein targeting.

Molekulargewicht: 45 kDa (MW of target protein)