SLC30A8 Antikörper
-
- Target Alle SLC30A8 Antikörper anzeigen
- SLC30A8 (Solute Carrier Family 30 (Zinc Transporter), Member 8 (SLC30A8))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC30A8 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC30 A8 antibody was raised using a synthetic peptide corresponding to a region with amino acids LLIDLTSFLLSLFSLWLSSKPPSKRLTFGWHRAEILGALLSILCIWVVTG
- Top Product
- Discover our top product SLC30A8 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC30A8 Blocking Peptide, catalog no. 33R-5148, is also available for use as a blocking control in assays to test for specificity of this SLC30A8 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC30 8 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC30A8 (Solute Carrier Family 30 (Zinc Transporter), Member 8 (SLC30A8))
- Andere Bezeichnung
- SLC30A8 (SLC30A8 Produkte)
- Synonyme
- C820002P14Rik antikoerper, ZnT-8 antikoerper, ZnT8 antikoerper, slc30a3 antikoerper, znt8 antikoerper, ZNT8 antikoerper, E130106K10Rik antikoerper, Gm212 antikoerper, wu:fe49g03 antikoerper, RGD1305098 antikoerper, solute carrier family 30 member 8 antikoerper, solute carrier family 30 (zinc transporter), member 8 antikoerper, solute carrier family 30 (zinc transporter), member 8 L homeolog antikoerper, solute carrier family 30, member 10 antikoerper, SLC30A8 antikoerper, Slc30a8 antikoerper, slc30a8.L antikoerper, slc30a8 antikoerper, Slc30a10 antikoerper
- Hintergrund
- The protein encoded by this gene is a zinc efflux transporter involved in the accumulation of zinc in intracellular vesicles. This gene is expressed at a high level only in the pancreas, particularly in islets of Langerhans.
- Molekulargewicht
- 41 kDa (MW of target protein)
- Pathways
- Positive Regulation of Peptide Hormone Secretion, Hormone Transport, Carbohydrate Homeostasis, Transition Metal Ion Homeostasis
-