LFNG Antikörper (N-Term)

Produktnummer ABIN634905

Produktdetails anti-LFNG Antikörper

Target: LFNG (LFNG O-Fucosylpeptide 3-beta-N-Acetylglucosaminyltransferase (LFNG))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser LFNG Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: LFNG antibody was raised against the N terminal of LFNG

Aufreinigung: Affinity purified

Immunogen: LFNG antibody was raised using the N terminal of LFNG corresponding to a region with amino acids LSEYFSLLTRARRDAGPPPGAAPRPADGHPRPLAEPLAPRDVFIAVKTTK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

LFNG Blocking Peptide, catalog no. 33R-5423, is also available for use as a blocking control in assays to test for specificity of this LFNG antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LFNG antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu LFNG

Target: LFNG (LFNG O-Fucosylpeptide 3-beta-N-Acetylglucosaminyltransferase (LFNG))

Andere Bezeichnung: LFNG (LFNG Produkte)

Synonyme: SCDO3 antikoerper, AW061165 antikoerper, id:ibd2614 antikoerper, id:ibd5029 antikoerper, id:ibd5138 antikoerper, l-fng antikoerper, wu:fc69h02 antikoerper, wu:fi34c01 antikoerper, LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase antikoerper, LFNG O-fucosylpeptide 3-beta-N-acetylglucosaminyltransferase S homeolog antikoerper, LFNG antikoerper, Lfng antikoerper, lfng.S antikoerper, lfng antikoerper

Hintergrund: LFNG is a member of the glycosyltransferase superfamily. It is a single-pass type II Golgi membrane protein that functions as a fucose-specific glycosyltransferase, adding an N-acetylglucosamine to the fucose residue of a group of signaling receptors involved in regulating cell fate decisions during development. Mutations in the gene that encodes this protein have been associated with autosomal recessive spondylocostal dysostosis 3.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Notch Signalweg