Tricellulin Antikörper (Middle Region)
-
- Target Alle Tricellulin (MARVELD2) Antikörper anzeigen
- Tricellulin (MARVELD2)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Tricellulin Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- MARVELD2 antibody was raised against the middle region of MARVELD2
- Aufreinigung
- Affinity purified
- Immunogen
- MARVELD2 antibody was raised using the middle region of MARVELD2 corresponding to a region with amino acids PKTPFVLVVAGLAWITTIIILVLGMSMYYRTILLDSNWWPLTEFGINVAL
- Top Product
- Discover our top product MARVELD2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MARVELD2 Blocking Peptide, catalog no. 33R-7179, is also available for use as a blocking control in assays to test for specificity of this MARVELD2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MARVELD2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Tricellulin (MARVELD2)
- Andere Bezeichnung
- MARVELD2 (MARVELD2 Produkte)
- Synonyme
- Mrvldc2 antikoerper, BC003296 antikoerper, MARVD2 antikoerper, Tric antikoerper, Trica antikoerper, Tricb antikoerper, Tricc antikoerper, DFNB49 antikoerper, MRVLDC2 antikoerper, MARVEL domain containing 2 antikoerper, MARVEL (membrane-associating) domain containing 2 antikoerper, Marveld2 antikoerper, MARVELD2 antikoerper
- Hintergrund
- Tight junctions (TJ) prevent leakage of solutes through the paracellular pathway of epithelial cells. MARVELD2, or tricellulin (TRIC), is an integral membrane protein concentrated at the vertically oriented TJ strands of tricellular contacts.
- Molekulargewicht
- 52 kDa (MW of target protein)
- Pathways
- Sensory Perception of Sound, Cell-Cell Junction Organization
-