CMTM2 Antikörper (N-Term)

Produktnummer ABIN634911

Produktdetails anti-CMTM2 Antikörper

Target: CMTM2 (CKLF-Like MARVEL Transmembrane Domain Containing 2 (CMTM2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CMTM2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: CMTM2 antibody was raised against the N terminal of CMTM2

Aufreinigung: Affinity purified

Immunogen: CMTM2 antibody was raised using the N terminal of CMTM2 corresponding to a region with amino acids DKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRRYRWELKDSNKEFWLL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

CMTM2 Blocking Peptide, catalog no. 33R-2029, is also available for use as a blocking control in assays to test for specificity of this CMTM2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CMTM2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CMTM2

Target: CMTM2 (CKLF-Like MARVEL Transmembrane Domain Containing 2 (CMTM2))

Andere Bezeichnung: CMTM2 (CMTM2 Produkte)

Synonyme: CKLFSF2 antikoerper, CKLF like MARVEL transmembrane domain containing 2 antikoerper, CMTM2 antikoerper

Hintergrund: CMTM2 belongs to the chemokine-like factor superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein may play an important role in testicular development. This gene belongs to the chemokine-like factor geneuperfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development.

Molekulargewicht: 27 kDa (MW of target protein)