CMTM2 Antikörper (N-Term)
-
- Target Alle CMTM2 Antikörper anzeigen
- CMTM2 (CKLF-Like MARVEL Transmembrane Domain Containing 2 (CMTM2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CMTM2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CMTM2 antibody was raised against the N terminal of CMTM2
- Aufreinigung
- Affinity purified
- Immunogen
- CMTM2 antibody was raised using the N terminal of CMTM2 corresponding to a region with amino acids DKPQKAVQDHKEPSDKPQKAVQPKHEVGTRRGCRRYRWELKDSNKEFWLL
- Top Product
- Discover our top product CMTM2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CMTM2 Blocking Peptide, catalog no. 33R-2029, is also available for use as a blocking control in assays to test for specificity of this CMTM2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CMTM2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CMTM2 (CKLF-Like MARVEL Transmembrane Domain Containing 2 (CMTM2))
- Andere Bezeichnung
- CMTM2 (CMTM2 Produkte)
- Hintergrund
- CMTM2 belongs to the chemokine-like factor superfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein may play an important role in testicular development. This gene belongs to the chemokine-like factor geneuperfamily, a novel family that links the chemokine and the transmembrane 4 superfamilies of signaling molecules. The protein encoded by this gene may play an important role in testicular development.
- Molekulargewicht
- 27 kDa (MW of target protein)
-