LST-3TM12 Antikörper (Middle Region)
-
- Target Alle LST-3TM12 Produkte
- LST-3TM12 (Organic Anion Transporter LST-3b (LST-3TM12))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser LST-3TM12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- LST-3 TM12 antibody was raised against the middle region of LST-3 M12
- Aufreinigung
- Affinity purified
- Immunogen
- LST-3 TM12 antibody was raised using the middle region of LST-3 M12 corresponding to a region with amino acids LKTNDKRNQIANLTNRRKYITKNVTGFFQSLKSILTNPLYVIFVIFTLLH
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
LST-3TM12 Blocking Peptide, catalog no. 33R-5109, is also available for use as a blocking control in assays to test for specificity of this LST-3TM12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of LST-0 M12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- LST-3TM12 (Organic Anion Transporter LST-3b (LST-3TM12))
- Andere Bezeichnung
- LST-3TM12 (LST-3TM12 Produkte)
- Synonyme
- LST-3 antikoerper, LST-3TM12 antikoerper, LST3 antikoerper, SLC21A21 antikoerper, solute carrier organic anion transporter family member 1B7 (putative) antikoerper, SLCO1B7 antikoerper
- Hintergrund
- The function of LST-3TM12 protein has not been widely studied, and is yet to be fully elucidated.
- Molekulargewicht
- 71 kDa (MW of target protein)
-