CLDND1 Antikörper (Middle Region)

Produktnummer ABIN634913

Produktdetails anti-CLDND1 Antikörper

Target: CLDND1 (Claudin Domain Containing 1 (CLDND1))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser CLDND1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: Claudin Domain Containing 1 antibody was raised against the middle region of CLDND1

Aufreinigung: Affinity purified

Immunogen: Claudin Domain Containing 1 antibody was raised using the middle region of CLDND1 corresponding to a region with amino acids TLTEQFMEKFVDPGNHNSGIDLLRTYLWRCQFLLPFVSLGLMCFGALIGL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

Claudin Domain Containing 1 Blocking Peptide, catalog no. 33R-9186, is also available for use as a blocking control in assays to test for specificity of this Claudin Domain Containing 1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CLDND1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu CLDND1

Target: CLDND1 (Claudin Domain Containing 1 (CLDND1))

Andere Bezeichnung: Claudin Domain Containing 1 (CLDND1 Produkte)

Synonyme: MGC53751 antikoerper, LOC100217896 antikoerper, 1110019C08Rik antikoerper, AA407103 antikoerper, AI849195 antikoerper, AW489850 antikoerper, Cldnd1 antikoerper, C3orf4 antikoerper, GENX-3745 antikoerper, claudin domain containing 1 L homeolog antikoerper, claudin domain containing 1 antikoerper, cldnd1.L antikoerper, cldnd1 antikoerper, CLDND1 antikoerper, Cldnd1 antikoerper

Hintergrund: CLDND1 belongs to the PMP-22/EMP/MP20 family. The exact function of CLDND1 remains unknown.

Molekulargewicht: 28 kDa (MW of target protein)