Metaxin 1 Antikörper (C-Term)
-
- Target Alle Metaxin 1 (MTX1) Antikörper anzeigen
- Metaxin 1 (MTX1)
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Metaxin 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Metaxin 1 antibody was raised against the C terminal of MTX1
- Aufreinigung
- Affinity purified
- Immunogen
- Metaxin 1 antibody was raised using the C terminal of MTX1 corresponding to a region with amino acids CLTLLSQRLGSQKFFFGDAPASLDAFVFSYLALLLQAKLPSGKLQVHLRG
- Top Product
- Discover our top product MTX1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Metaxin 1 Blocking Peptide, catalog no. 33R-1748, is also available for use as a blocking control in assays to test for specificity of this Metaxin 1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MTX1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Metaxin 1 (MTX1)
- Andere Bezeichnung
- Metaxin 1 (MTX1 Produkte)
- Synonyme
- MTX antikoerper, MTXN antikoerper, Gcap6 antikoerper, Mtx antikoerper, mtx1 antikoerper, zgc:101675 antikoerper, Metaxin-1 antikoerper, metaxin 1 antikoerper, metaxin 1b antikoerper, Metaxin 1 antikoerper, metaxin 1 S homeolog antikoerper, metaxin 1 (predicted) antikoerper, metaxin-1 antikoerper, MTX1 antikoerper, Mtx1 antikoerper, mtx1b antikoerper, mtx1.S antikoerper, mtx1 antikoerper, SPAC589.04 antikoerper, LOC100587360 antikoerper
- Hintergrund
- MTX1 belongs to the metaxin family. It is involved in transport of proteins into the mitochondrion and essential for embryonic development.
- Molekulargewicht
- 51 kDa (MW of target protein)
- Pathways
- Dicarboxylic Acid Transport
-