Surfeit 4 Antikörper (N-Term)
-
- Target Alle Surfeit 4 (SURF4) Antikörper anzeigen
- Surfeit 4 (SURF4)
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Maus, Human, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Surfeit 4 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- SURF4 antibody was raised against the N terminal of SURF4
- Aufreinigung
- Affinity purified
- Immunogen
- SURF4 antibody was raised using the N terminal of SURF4 corresponding to a region with amino acids GQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQ
- Top Product
- Discover our top product SURF4 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SURF4 Blocking Peptide, catalog no. 33R-3504, is also available for use as a blocking control in assays to test for specificity of this SURF4 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SURF4 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Surfeit 4 (SURF4)
- Andere Bezeichnung
- SURF4 (SURF4 Produkte)
- Hintergrund
- SURF4 is a conserved integral membrane protein containing multiple putative transmembrane regions. In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). The specific function of this protein has not been determined but its yeast homolog is directly required for packaging glycosylated pro-alpha-factor into COPII vesicles.
- Molekulargewicht
- 30 kDa (MW of target protein)
-