Surfeit 4 Antikörper (N-Term)

Produktnummer ABIN634922

Produktdetails anti-Surfeit 4 Antikörper

Target: Surfeit 4 (SURF4)

Bindungsspezifität: N-Term

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Surfeit 4 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SURF4 antibody was raised against the N terminal of SURF4

Aufreinigung: Affinity purified

Immunogen: SURF4 antibody was raised using the N terminal of SURF4 corresponding to a region with amino acids GQNDLMGTAEDFADQFLRVTKQYLPHVARLCLISTFLEDGIRMWFQWSEQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SURF4 Blocking Peptide, catalog no. 33R-3504, is also available for use as a blocking control in assays to test for specificity of this SURF4 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SURF4 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Surfeit 4

Target: Surfeit 4 (SURF4)

Andere Bezeichnung: SURF4 (SURF4 Produkte)

Synonyme: CG6202 antikoerper, Dmel\\CG6202 antikoerper, SURF-4 antikoerper, Surf-4 antikoerper, SURF4 antikoerper, MGC88894 antikoerper, GB14656 antikoerper, Surf4 antikoerper, DKFZp459A164 antikoerper, ERV29 antikoerper, erv29 antikoerper, surf4 antikoerper, zgc:65806 antikoerper, zgc:77007 antikoerper, AL033340 antikoerper, AL033373 antikoerper, Surfeit 4 antikoerper, surfeit 4 antikoerper, surfeit 4, gene 1 antikoerper, surfeit locus protein 4 homolog antikoerper, surfeit 4, gene 1 L homeolog antikoerper, surfeit gene 4 antikoerper, Surf4 antikoerper, SURF4 antikoerper, surf4.1 antikoerper, LOC552234 antikoerper, surf4.1.L antikoerper, surf4 antikoerper

Hintergrund: SURF4 is a conserved integral membrane protein containing multiple putative transmembrane regions. In eukaryotic cells, protein transport between the endoplasmic reticulum and Golgi compartments is mediated in part by non-clathrin-coated vesicular coat proteins (COPs). The specific function of this protein has not been determined but its yeast homolog is directly required for packaging glycosylated pro-alpha-factor into COPII vesicles.

Molekulargewicht: 30 kDa (MW of target protein)