TRIM59 Antikörper (N-Term)
-
- Target Alle TRIM59 Antikörper anzeigen
- TRIM59 (Tripartite Motif Containing 59 (TRIM59))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TRIM59 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TRIM59 antibody was raised against the N terminal of TRIM59
- Aufreinigung
- Affinity purified
- Immunogen
- TRIM59 antibody was raised using the N terminal of TRIM59 corresponding to a region with amino acids RIPLKCPNCRSITEIAPTGIESLPVNFALRAIIEKYQQEDHPDIVTCPEH
- Top Product
- Discover our top product TRIM59 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TRIM59 Blocking Peptide, catalog no. 33R-7974, is also available for use as a blocking control in assays to test for specificity of this TRIM59 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TRIM59 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TRIM59 (Tripartite Motif Containing 59 (TRIM59))
- Andere Bezeichnung
- TRIM59 (TRIM59 Produkte)
- Synonyme
- zgc:193694 antikoerper, zgc:193700 antikoerper, TRIM59 antikoerper, MRF1 antikoerper, RNF104 antikoerper, TRIM57 antikoerper, TSBF1 antikoerper, 2310035M22Rik antikoerper, 2700022F13Rik antikoerper, Mrf1 antikoerper, RGD1311956 antikoerper, LYR motif containing 9 antikoerper, tripartite motif containing 59 antikoerper, tripartite motif-containing 59 antikoerper, lyrm9 antikoerper, TRIM59 antikoerper, Trim59 antikoerper
- Hintergrund
- The function of TRIM59 protein is not widely studied, and is yet to be elucidated fully.
- Molekulargewicht
- 44 kDa (MW of target protein)
- Pathways
- SARS-CoV-2 Protein Interaktom
-