FAM20C Antikörper (Middle Region)
-
- Target Alle FAM20C Antikörper anzeigen
- FAM20C (Family with Sequence Similarity 20, Member C (FAM20C))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Ratte, Maus
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FAM20C Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- FAM20 C antibody was raised against the middle region of FAM20
- Aufreinigung
- Affinity purified
- Immunogen
- FAM20 C antibody was raised using the middle region of FAM20 corresponding to a region with amino acids CFYGECSYYCSTEHALCGKPDQIEGSLAAFLPDLSLAKRKTWRNPWRRSY
- Top Product
- Discover our top product FAM20C Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FAM20C Blocking Peptide, catalog no. 33R-1689, is also available for use as a blocking control in assays to test for specificity of this FAM20C antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM20 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FAM20C (Family with Sequence Similarity 20, Member C (FAM20C))
- Andere Bezeichnung
- FAM20C (FAM20C Produkte)
- Synonyme
- DMP-4 antikoerper, DMP4 antikoerper, GEF-CK antikoerper, RNS antikoerper, C76981 antikoerper, mKIAA4081 antikoerper, RGD1311980 antikoerper, si:ch73-266a4.1 antikoerper, FAM20C, golgi associated secretory pathway kinase antikoerper, family with sequence similarity 20, member C antikoerper, family with sequence similarity 20, member Cb antikoerper, FAM20C antikoerper, Fam20c antikoerper, fam20cb antikoerper
- Hintergrund
- FAM20C belongs to the FAM20 family. FAM20C is a calcium-binding protein which may play a role in dentin mineralization. Mutations in FAM20C are associated with lethal osteosclerotic bone dysplasia (Raine Syndrome), highlighting a crucial molecule in bone development.
- Molekulargewicht
- 66 kDa (MW of target protein)
-