FAM20C Antikörper (C-Term)

Produktnummer ABIN634926

Produktdetails anti-FAM20C Antikörper

Target: FAM20C (Family with Sequence Similarity 20, Member C (FAM20C))

Bindungsspezifität: C-Term

Reaktivität: Human, Ratte, Maus

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser FAM20C Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: FAM20 C antibody was raised against the C terminal of FAM20

Aufreinigung: Affinity purified

Immunogen: FAM20 C antibody was raised using the C terminal of FAM20 corresponding to a region with amino acids NETFIIHLDNGRGFGKYSHDELSILVPLQQCCRIRKSTYLRLQLLAKEEY

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

FAM20C Blocking Peptide, catalog no. 33R-6677, is also available for use as a blocking control in assays to test for specificity of this FAM20C antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FAM20 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu FAM20C

Target: FAM20C (Family with Sequence Similarity 20, Member C (FAM20C))

Andere Bezeichnung: FAM20C (FAM20C Produkte)

Synonyme: DMP-4 antikoerper, DMP4 antikoerper, GEF-CK antikoerper, RNS antikoerper, C76981 antikoerper, mKIAA4081 antikoerper, RGD1311980 antikoerper, si:ch73-266a4.1 antikoerper, FAM20C, golgi associated secretory pathway kinase antikoerper, family with sequence similarity 20, member C antikoerper, family with sequence similarity 20, member Cb antikoerper, FAM20C antikoerper, Fam20c antikoerper, fam20cb antikoerper

Hintergrund: FAM20C belongs to the FAM20 family. FAM20C is a calcium-binding protein which may play a role in dentin mineralization. Mutations in FAM20C are associated with lethal osteosclerotic bone dysplasia (Raine Syndrome), highlighting a crucial molecule in bone development.

Molekulargewicht: 66 kDa (MW of target protein)