Patched 1 Antikörper
-
- Target Alle Patched 1 (PTCH1) Antikörper anzeigen
- Patched 1 (PTCH1)
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Patched 1 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- PTCH1 antibody was raised using a synthetic peptide corresponding to a region with amino acids TILGVLNGLVLLPVLLSFFGPYPEVSPANGLNRLPTPSPEPPPSVVRFAM
- Top Product
- Discover our top product PTCH1 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PTCH1 Blocking Peptide, catalog no. 33R-9121, is also available for use as a blocking control in assays to test for specificity of this PTCH1 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PTCH1 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Patched 1 (PTCH1)
- Andere Bezeichnung
- PTCH1 (PTCH1 Produkte)
- Synonyme
- BCNS antikoerper, HPE7 antikoerper, NBCCS antikoerper, PTC antikoerper, PTC1 antikoerper, PTCH antikoerper, PTCH11 antikoerper, lep antikoerper, ptc1 antikoerper, ptc2 antikoerper, Ptch antikoerper, Ptch2 antikoerper, Ptc-1 antikoerper, XPtc1 antikoerper, patched antikoerper, patched1 antikoerper, A230106A15Rik antikoerper, Ptc antikoerper, Ptc1 antikoerper, mes antikoerper, patched 1 antikoerper, patched 1 L homeolog antikoerper, Protein patched homolog 1 antikoerper, PTCH1 antikoerper, ptch1 antikoerper, Ptch1 antikoerper, ptch1.L antikoerper, ptc-1 antikoerper
- Hintergrund
- PTCH1 is a member of the patched gene family. The protein is the receptor for sonic hedgehog, a secreted molecule implicated in the formation of embryonic structures and in tumorigenesis. It functions as a tumor suppressor. Mutations of its gene have been associated with nevoid basal cell carcinoma syndrome, esophageal squamous cell carcinoma, trichoepitheliomas, transitional cell carcinomas of the bladder, as well as holoprosencephaly.
- Molekulargewicht
- 37 kDa (MW of target protein)
- Pathways
- Hedgehog Signalweg, Carbohydrate Homeostasis, Tube Formation
-