Kallikrein 5 Antikörper (N-Term)

Produktnummer ABIN634928

Produktdetails anti-Kallikrein 5 Antikörper

Target: Kallikrein 5 (KLK5)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser Kallikrein 5 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: KLK5 antibody was raised against the N terminal of KLK5

Aufreinigung: Affinity purified

Immunogen: KLK5 antibody was raised using the N terminal of KLK5 corresponding to a region with amino acids CDHPSNTVPSGSNQDLGAGAGEDARSDDSSSRIINGSDCDMHTQPWQAAL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

KLK5 Blocking Peptide, catalog no. 33R-1662, is also available for use as a blocking control in assays to test for specificity of this KLK5 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of KLK5 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu Kallikrein 5

Target: Kallikrein 5 (KLK5)

Andere Bezeichnung: KLK5 (KLK5 Produkte)

Synonyme: KLK-L2 antikoerper, KLKL2 antikoerper, SCTE antikoerper, 1110030O19Rik antikoerper, KAL antikoerper, KALA antikoerper, Klk1 antikoerper, Klk5 antikoerper, RATKALA antikoerper, kallikrein related peptidase 5 antikoerper, kallikrein related-peptidase 5 antikoerper, kallikrein 5-like antikoerper, KLK5 antikoerper, Klk5 antikoerper, Klk5l antikoerper

Hintergrund: Kallikreins are a subgroup of serine proteases having diverse physiological functions. Growing evidence suggests that many kallikreins are implicated in carcinogenesis and some have potential as novel cancer and other disease biomarkers.

Molekulargewicht: 25 kDa (MW of target protein)

Pathways: Komplementsystem, Regulation of G-Protein Coupled Receptor Protein Signaling