MMP24 Antikörper
-
- Target Alle MMP24 Antikörper anzeigen
- MMP24 (Matrix Metallopeptidase 24 (Membrane-inserted) (MMP24))
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MMP24 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- MMP24 antibody was raised using a synthetic peptide corresponding to a region with amino acids GSCLPREGIDTALRWEPVGKTYFFKGERYWRYSEERRATDPGYPKPITVW
- Top Product
- Discover our top product MMP24 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MMP24 Blocking Peptide, catalog no. 33R-3551, is also available for use as a blocking control in assays to test for specificity of this MMP24 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MMP24 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MMP24 (Matrix Metallopeptidase 24 (Membrane-inserted) (MMP24))
- Andere Bezeichnung
- MMP24 (MMP24 Produkte)
- Synonyme
- MMP-24 antikoerper, MMP25 antikoerper, MT-MMP 5 antikoerper, MT-MMP5 antikoerper, MT5-MMP antikoerper, MT5MMP antikoerper, MTMMP5 antikoerper, AU040325 antikoerper, Mt5-mmp antikoerper, si:ch211-239j9.5 antikoerper, MMP24 antikoerper, mt3-mmp antikoerper, matrix metallopeptidase 24 antikoerper, matrix metallopeptidase 16 S homeolog antikoerper, MMP24 antikoerper, Mmp24 antikoerper, mmp24 antikoerper, mmp16.S antikoerper
- Hintergrund
- This protein activates MMP2 by cleavage. The gene has previously been referred to as MMP25 but has been renamed MMP24.
- Molekulargewicht
- 57 kDa (MW of target protein)
-