SPATA9 Antikörper (N-Term)

Produktnummer ABIN634932

Produktdetails anti-SPATA9 Antikörper

Target: SPATA9 (Spermatogenesis Associated 9 (SPATA9))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SPATA9 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SPATA9 antibody was raised against the N terminal of SPATA9

Aufreinigung: Affinity purified

Immunogen: SPATA9 antibody was raised using the N terminal of SPATA9 corresponding to a region with amino acids PIKPVGWICGQVLKNFSGRIEGIQKAIMDLVDEFKDEFPTILRLSQSNQK

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SPATA9 Blocking Peptide, catalog no. 33R-7156, is also available for use as a blocking control in assays to test for specificity of this SPATA9 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SPATA9 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SPATA9

Target: SPATA9 (Spermatogenesis Associated 9 (SPATA9))

Andere Bezeichnung: SPATA9 (SPATA9 Produkte)

Synonyme: SPATA9 antikoerper, NYD-SP16 antikoerper, 1700030K01Rik antikoerper, 4930599C08Rik antikoerper, A930023H06Rik antikoerper, spermatogenesis associated 9 antikoerper, SPATA9 antikoerper, Spata9 antikoerper

Hintergrund: SPATA9 may play a role in testicular development/spermatogenesis and may be an important factor in male infertility. Defects in expression of SPATA9 lead to Sertoli-cell-only syndrome.

Molekulargewicht: 29 kDa (MW of target protein)