Derlin-3 Antikörper (C-Term)
-
- Target Alle Derlin-3 (DERL3) Antikörper anzeigen
- Derlin-3 (DERL3) (Der1-Like Domain Family, Member 3 (DERL3))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Derlin-3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- DERL3 antibody was raised against the C terminal of DERL3
- Aufreinigung
- Affinity purified
- Immunogen
- DERL3 antibody was raised using the C terminal of DERL3 corresponding to a region with amino acids YYFLEDVFPNQPGGKRLLQTPGFLKLLLDAPAEDPNYLPLPEEQPGPHLP
- Top Product
- Discover our top product DERL3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
DERL3 Blocking Peptide, catalog no. 33R-10295, is also available for use as a blocking control in assays to test for specificity of this DERL3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of DERL3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Derlin-3 (DERL3) (Der1-Like Domain Family, Member 3 (DERL3))
- Andere Bezeichnung
- DERL3 (DERL3 Produkte)
- Hintergrund
- DERL3 belongs to the derlin family, and resides in the endoplasmic reticulum (ER). Proteins that are unfolded or misfolded in the ER must be refolded or degraded to maintain the homeostasis of the ER. This protein appears to be involved in the degradation of misfolded glycoproteins in the ER. Several alternatively spliced transcript variants encoding different isoforms have been identified for this gene.
- Molekulargewicht
- 27 kDa (MW of target protein)
- Pathways
- ER-Nucleus Signaling
-