POMT2 Antikörper (Middle Region)

Produktnummer ABIN634940

Produktdetails anti-POMT2 Antikörper

Target: POMT2 (Protein-O-Mannosyltransferase 2 (POMT2))

Bindungsspezifität: Middle Region

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POMT2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: POMT2 antibody was raised against the middle region of POMT2

Aufreinigung: Affinity purified

Immunogen: POMT2 antibody was raised using the middle region of POMT2 corresponding to a region with amino acids RKHYQVTGYGINGTGDSNDFWRIEVVNRKFGNRIKVLRSRIRFIHLVTGC

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

POMT2 Blocking Peptide, catalog no. 33R-7995, is also available for use as a blocking control in assays to test for specificity of this POMT2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POMT2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu POMT2

Target: POMT2 (Protein-O-Mannosyltransferase 2 (POMT2))

Andere Bezeichnung: POMT2 (POMT2 Produkte)

Synonyme: CG12311 antikoerper, DPOMT2 antikoerper, DmPOMT2 antikoerper, Dmel\\CG12311 antikoerper, EG:34F3.7 antikoerper, POMT2 antikoerper, Pomt2 antikoerper, dPOMT2 antikoerper, im:7153045 antikoerper, zPOMT2 antikoerper, zgc:158749 antikoerper, LGMD2N antikoerper, MDDGA2 antikoerper, MDDGB2 antikoerper, MDDGC2 antikoerper, A830009D15Rik antikoerper, AW046274 antikoerper, twisted antikoerper, protein O-mannosyltransferase 2 antikoerper, protein-O-mannosyltransferase 2 antikoerper, tw antikoerper, POMT2 antikoerper, pomt2 antikoerper, Pomt2 antikoerper

Hintergrund: POMT2 encodes an integral membrane protein of the endoplasmic reticulum (ER) that shares significant sequence similarity with a family of protein O-mannosyltransferases of S.cerevisiae.

Molekulargewicht: 84 kDa (MW of target protein)