IMPAD1 Antikörper (N-Term)

Produktnummer ABIN634943

Produktdetails anti-IMPAD1 Antikörper

Target: IMPAD1 (Inositol Monophosphatase Domain Containing 1 (IMPAD1))

Bindungsspezifität: N-Term

Reaktivität: Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser IMPAD1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: IMPAD1 antibody was raised against the N terminal of IMPAD1

Aufreinigung: Affinity purified

Immunogen: IMPAD1 antibody was raised using the N terminal of IMPAD1 corresponding to a region with amino acids VLAAVRGGDEVRRVRESNVLHEKSKGKTREGAEDKMTSGDVLSNRKMFYL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

IMPAD1 Blocking Peptide, catalog no. 33R-9642, is also available for use as a blocking control in assays to test for specificity of this IMPAD1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of IMPAD1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu IMPAD1

Target: IMPAD1 (Inositol Monophosphatase Domain Containing 1 (IMPAD1))

Andere Bezeichnung: IMPAD1 (IMPAD1 Produkte)

Synonyme: IMP 3 antikoerper, RGD1306455 antikoerper, gPAPP antikoerper, impa3 antikoerper, 1110001C20Rik antikoerper, AA408880 antikoerper, AI451589 antikoerper, AL022796 antikoerper, B230207P20 antikoerper, Jaws antikoerper, GPAPP antikoerper, IMP-3 antikoerper, IMPA3 antikoerper, IMPase 3 antikoerper, zgc:123256 antikoerper, inositol monophosphatase domain containing 1 antikoerper, inositol monophosphatase domain containing 1 S homeolog antikoerper, Impad1 antikoerper, impad1.S antikoerper, IMPAD1 antikoerper, impad1 antikoerper

Hintergrund: The function of IMPAD protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 39 kDa (MW of target protein)

Pathways: Glycosaminoglycan Metabolic Process