TMEM30A Antikörper (N-Term)

Produktnummer ABIN634944

Produktdetails anti-TMEM30A Antikörper

Target: TMEM30A (Transmembrane Protein 30A (TMEM30A))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte, Hund, Zebrafisch (Danio rerio)

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM30A Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: TMEM30 A antibody was raised against the N terminal of TMEM30

Aufreinigung: Affinity purified

Immunogen: TMEM30 A antibody was raised using the N terminal of TMEM30 corresponding to a region with amino acids FTLEKSFEGNVFMYYGLSNFYQNHRRYVKSRDDSQLNGDSSALLNPSKEC

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM30A Blocking Peptide, catalog no. 33R-3094, is also available for use as a blocking control in assays to test for specificity of this TMEM30A antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM30 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM30A

Target: TMEM30A (Transmembrane Protein 30A (TMEM30A))

Andere Bezeichnung: TMEM30A (TMEM30A Produkte)

Synonyme: tmem30a antikoerper, wu:fj66b08 antikoerper, zgc:91877 antikoerper, fi23a10 antikoerper, wu:fb15c10 antikoerper, wu:fi23a10 antikoerper, zgc:55379 antikoerper, zgc:77655 antikoerper, cg9947 antikoerper, MGC53259 antikoerper, MGC75889 antikoerper, CDC50A antikoerper, DKFZp459A091 antikoerper, DKFZp459D097 antikoerper, DKFZp459B0431 antikoerper, C6orf67 antikoerper, 2010200I23Rik antikoerper, AW540225 antikoerper, Cdc50a antikoerper, D9Wsu20e antikoerper, transmembrane protein 30Aa antikoerper, transmembrane protein 30A antikoerper, transmembrane protein 30Ab antikoerper, transmembrane protein 30A L homeolog antikoerper, tmem30aa antikoerper, TMEM30A antikoerper, tmem30ab antikoerper, tmem30a.L antikoerper, tmem30a antikoerper, LOAG_03933 antikoerper, Tmem30a antikoerper

Hintergrund: The function of TMEM30A protein is not widely studied, and is yet to be elucidated fully.

Molekulargewicht: 41 kDa (MW of target protein)