MFF Antikörper (C-Term)
-
- Target Alle MFF Antikörper anzeigen
- MFF (Mitochondrial Fission Factor (MFF))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MFF Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C2 ORF33 antibody was raised against the C terminal Of C2 rf33
- Aufreinigung
- Affinity purified
- Immunogen
- C2 ORF33 antibody was raised using the C terminal Of C2 rf33 corresponding to a region with amino acids VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW
- Top Product
- Discover our top product MFF Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C2ORF33 Blocking Peptide, catalog no. 33R-9870, is also available for use as a blocking control in assays to test for specificity of this C2ORF33 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF33 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MFF (Mitochondrial Fission Factor (MFF))
- Andere Bezeichnung
- C2ORF33 (MFF Produkte)
- Synonyme
- zgc:66022 antikoerper, mff antikoerper, gl004 antikoerper, MGC79121 antikoerper, MGC80099 antikoerper, C2orf33 antikoerper, GL004 antikoerper, C2H2orf33 antikoerper, 5230400G24Rik antikoerper, AI314724 antikoerper, RGD1310230 antikoerper, mitochondrial fission factor antikoerper, mitochondrial fission factor L homeolog antikoerper, mitochondrial fission factor S homeolog antikoerper, mff antikoerper, mff.L antikoerper, mff.S antikoerper, MFF antikoerper, Mff antikoerper
- Hintergrund
- C2orf33 plays a role in mitochondrial and peroxisomal fission.
- Molekulargewicht
- 38 kDa (MW of target protein)
-