MFF Antikörper (C-Term)

Produktnummer ABIN634945

Produktdetails anti-MFF Antikörper

Target: MFF (Mitochondrial Fission Factor (MFF))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser MFF Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C2 ORF33 antibody was raised against the C terminal Of C2 rf33

Aufreinigung: Affinity purified

Immunogen: C2 ORF33 antibody was raised using the C terminal Of C2 rf33 corresponding to a region with amino acids VVDAASLRRQIIKLNRRLQLLEEENKERAKREMVMYSITVAFWLLNSWLW

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C2ORF33 Blocking Peptide, catalog no. 33R-9870, is also available for use as a blocking control in assays to test for specificity of this C2ORF33 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C0 RF33 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu MFF

Target: MFF (Mitochondrial Fission Factor (MFF))

Andere Bezeichnung: C2ORF33 (MFF Produkte)

Hintergrund: C2orf33 plays a role in mitochondrial and peroxisomal fission.

Molekulargewicht: 38 kDa (MW of target protein)