POPDC3 Antikörper (C-Term)

Produktnummer ABIN634947

Produktdetails anti-POPDC3 Antikörper

Target: POPDC3 (Popeye Domain Containing 3 (POPDC3))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser POPDC3 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: POPDC3 antibody was raised against the C terminal of POPDC3

Aufreinigung: Affinity purified

Immunogen: POPDC3 antibody was raised using the C terminal of POPDC3 corresponding to a region with amino acids YLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQ

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

POPDC3 Blocking Peptide, catalog no. 33R-10174, is also available for use as a blocking control in assays to test for specificity of this POPDC3 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POPDC3 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu POPDC3

Target: POPDC3 (Popeye Domain Containing 3 (POPDC3))

Andere Bezeichnung: POPDC3 (POPDC3 Produkte)

Synonyme: pop3 antikoerper, POP1 antikoerper, POP3 antikoerper, RP11-99L11.2 antikoerper, bA355M14.1 antikoerper, AA682104 antikoerper, Pop3 antikoerper, popeye domain containing 3 antikoerper, POPDC3 antikoerper, popdc3 antikoerper, Popdc3 antikoerper

Hintergrund: POPDC3 is a member of the POP family of proteins containing three putative transmembrane domains. The protein is expressed in cardiac and skeletal muscle and may play an important role in these tissues during development.

Molekulargewicht: 34 kDa (MW of target protein)