POPDC3 Antikörper (C-Term)
-
- Target Alle POPDC3 Antikörper anzeigen
- POPDC3 (Popeye Domain Containing 3 (POPDC3))
-
Bindungsspezifität
- C-Term
-
Reaktivität
- Human, Maus, Ratte
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser POPDC3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- POPDC3 antibody was raised against the C terminal of POPDC3
- Aufreinigung
- Affinity purified
- Immunogen
- POPDC3 antibody was raised using the C terminal of POPDC3 corresponding to a region with amino acids YLLFAQHRYISRLFSVLIGSDIADKLYALNDRVYIGKRYHYDIRLPNFYQ
- Top Product
- Discover our top product POPDC3 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
POPDC3 Blocking Peptide, catalog no. 33R-10174, is also available for use as a blocking control in assays to test for specificity of this POPDC3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of POPDC3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- POPDC3 (Popeye Domain Containing 3 (POPDC3))
- Andere Bezeichnung
- POPDC3 (POPDC3 Produkte)
- Hintergrund
- POPDC3 is a member of the POP family of proteins containing three putative transmembrane domains. The protein is expressed in cardiac and skeletal muscle and may play an important role in these tissues during development.
- Molekulargewicht
- 34 kDa (MW of target protein)
-