PAQR6 Antikörper (N-Term)

Produktnummer ABIN634948

Produktdetails anti-PAQR6 Antikörper

Target: PAQR6 (Progestin and AdipoQ Receptor Family Member VI (PAQR6))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser PAQR6 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: PAQR6 antibody was raised against the N terminal of PAQR6

Aufreinigung: Affinity purified

Immunogen: PAQR6 antibody was raised using the N terminal of PAQR6 corresponding to a region with amino acids PGLSKVLRTGAFAYPFLFDNLPLFYRLGLCWGRGHGCGQEALSTSHGYHL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

PAQR6 Blocking Peptide, catalog no. 33R-7117, is also available for use as a blocking control in assays to test for specificity of this PAQR6 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PAQR6 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu PAQR6

Target: PAQR6 (Progestin and AdipoQ Receptor Family Member VI (PAQR6))

Andere Bezeichnung: PAQR6 (PAQR6 Produkte)

Synonyme: MGC115032 antikoerper, paqr6 antikoerper, 1500001B10Rik antikoerper, putative progestin and adipoq receptor family member VI antikoerper, progestin and adipoQ receptor family member VI L homeolog antikoerper, progestin and adipoQ receptor family member VI antikoerper, progestin and adipoQ receptor family member VI S homeolog antikoerper, progestin and adipoQ receptor family member 6 antikoerper, Smp_086190 antikoerper, paqr6.L antikoerper, paqr6 antikoerper, paqr6.S antikoerper, PAQR6 antikoerper, Paqr6 antikoerper

Hintergrund: This protein mediates receptor activity.

Molekulargewicht: 39 kDa (MW of target protein)