FTHL17 Antikörper (Middle Region)
-
- Target Alle FTHL17 Antikörper anzeigen
- FTHL17 (Ferritin, Heavy Polypeptide-Like 17 (FTHL17))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser FTHL17 Antikörper ist unkonjugiert
- Applikation
- Western Blotting (WB)
- Spezifität
- FTHL17 antibody was raised against the middle region of FTHL17
- Aufreinigung
- Affinity purified
- Immunogen
- FTHL17 antibody was raised using the middle region of FTHL17 corresponding to a region with amino acids FLESHYLHEQVKTIKELGGYVSNLRKICSPEAGLAEYLFDKLTLGGRVKE
- Top Product
- Discover our top product FTHL17 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
FTHL17 Blocking Peptide, catalog no. 33R-2958, is also available for use as a blocking control in assays to test for specificity of this FTHL17 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of FTHL17 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- FTHL17 (Ferritin, Heavy Polypeptide-Like 17 (FTHL17))
- Andere Bezeichnung
- FTHL17 (FTHL17 Produkte)
- Hintergrund
- This gene is similar to a mouse gene that encodes a ferritin heavy polypeptide-like protein.
- Molekulargewicht
- 21 kDa (MW of target protein)
- Pathways
- Transition Metal Ion Homeostasis
-