OMG Antikörper (N-Term)
-
- Target Alle OMG Antikörper anzeigen
- OMG (Oligodendrocyte Myelin Glycoprotein (OMG))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser OMG Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- OMG antibody was raised against the N terminal of OMG
- Aufreinigung
- Affinity purified
- Immunogen
- OMG antibody was raised using the N terminal of OMG corresponding to a region with amino acids ANNNIKLLDKSDTAYQWNLKYLDVSKNMLEKVVLIKNTLRSLEVLNLSSN
- Top Product
- Discover our top product OMG Primärantikörper
-
anti-Oligodendrocyte Myelin Glycoprotein (OMG) (AA 166-280) antibody
OMG Reaktivität: Maus, Ratte ELISA, WB, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Oligodendrocyte Myelin Glycoprotein (OMG) (AA 26-134) antibodyOMG Reaktivität: Human ELISA Wirt: Maus Monoclonal 1A8 unconjugated
anti-Oligodendrocyte Myelin Glycoprotein (OMG) (C-Term) antibodyOMG Reaktivität: Human WB, IHC (fro) Wirt: Kaninchen Polyclonal unconjugated
anti-Oligodendrocyte Myelin Glycoprotein (OMG) antibodyOMG Reaktivität: Human, Maus ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Oligodendrocyte Myelin Glycoprotein (OMG) (AA 190-420) antibodyOMG Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Oligodendrocyte Myelin Glycoprotein (OMG) (Internal Region) antibodyOMG Reaktivität: Human, Maus ELISA, WB, ICC, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Oligodendrocyte Myelin Glycoprotein (OMG) (Internal Region) antibodyVerified OMG Reaktivität: Human ELISA, WB Wirt: Ziege Polyclonal unconjugated
anti-Oligodendrocyte Myelin Glycoprotein (OMG) (AA 143-192) antibodyOMG Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Pferd WB Wirt: Kaninchen Polyclonal unconjugated
anti-Oligodendrocyte Myelin Glycoprotein (OMG) (AA 107-156) antibodyOMG Reaktivität: Human, Maus, Ratte, Hund, Meerschweinchen, Pferd, Kaninchen, Affe, Fledermaus WB Wirt: Kaninchen Polyclonal unconjugated
anti-Oligodendrocyte Myelin Glycoprotein (OMG) (N-Term) antibodyOMG Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Meerschweinchen, Pferd, Kaninchen WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
OMG Blocking Peptide, catalog no. 33R-1403, is also available for use as a blocking control in assays to test for specificity of this OMG antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of OMG antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- OMG (Oligodendrocyte Myelin Glycoprotein (OMG))
- Andere Bezeichnung
- OMG (OMG Produkte)
- Synonyme
- OMGP antikoerper, omgp antikoerper, MGC107958 antikoerper, OMG antikoerper, DKFZp459F1351 antikoerper, oligodendrocyte myelin glycoprotein antikoerper, myelin oligodendrocyte glycoprotein antikoerper, oligodendrocyte-myelin glycoprotein antikoerper, OMG antikoerper, MOG antikoerper, Omg antikoerper, omg antikoerper
- Hintergrund
- OMG is a cell adhesion molecule contributing to the interactive process required for myelination in the central nervous system.
- Molekulargewicht
- 49 kDa (MW of target protein)
- Pathways
- Neurotrophin Signalübertragung, Regulation of Cell Size
-
