GTPase, IMAP Family Member 1 (GIMAP1) (N-Term) Antikörper

Produktnummer ABIN634959

Produktdetails

Target: GTPase, IMAP Family Member 1 (GIMAP1)

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: GIMAP1 antibody was raised against the N terminal of GIMAP1

Aufreinigung: Affinity purified

Immunogen: GIMAP1 antibody was raised using the N terminal of GIMAP1 corresponding to a region with amino acids MGGRKMATDEENVYGLEENAQSRQESTRRLILVGRTGAGKSATGNSILGQ

Anwendungsinformationen

Applikationshinweise: WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

GIMAP1 Blocking Peptide, catalog no. 33R-6034, is also available for use as a blocking control in assays to test for specificity of this GIMAP1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of GIMAP1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Antigendetails

Target: GTPase, IMAP Family Member 1 (GIMAP1)

Andere Bezeichnung: GIMAP1 (GIMAP1 Produkte)

Synonyme: HIMAP1 antikoerper, IMAP1 antikoerper, IMAP38 antikoerper, IAP38 antikoerper, Imap38 antikoerper, imap antikoerper, Ian2 antikoerper, GTPase, IMAP family member 1 antikoerper, GIMAP1 antikoerper, Gimap1 antikoerper

Hintergrund: GIMAP1 belonging to the GTP-binding superfamily and to the immuno-associated nucleotide (IAN) subfamily of nucleotide-binding proteins.

Molekulargewicht: 34 kDa (MW of target protein)