STYK1 Antikörper (C-Term)

Produktnummer ABIN634962

Produktdetails anti-STYK1 Antikörper

Target: STYK1 (serine/threonine/tyrosine Kinase 1 (STYK1))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte, Hund

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser STYK1 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: STYK1 antibody was raised against the C terminal of STYK1

Aufreinigung: Affinity purified

Immunogen: STYK1 antibody was raised using the C terminal of STYK1 corresponding to a region with amino acids PERLLLRPASIRADVWSFGILLYEMVTLGAPPYPEVPPTSILEHLQRRKI

Anwendungsinformationen

Applikationshinweise: WB: 0.25 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

STYK1 Blocking Peptide, catalog no. 33R-7060, is also available for use as a blocking control in assays to test for specificity of this STYK1 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of STYK1 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu STYK1

Target: STYK1 (serine/threonine/tyrosine Kinase 1 (STYK1))

Andere Bezeichnung: STYK1 (STYK1 Produkte)

Synonyme: wu:fc39b09 antikoerper, wu:fe11d05 antikoerper, STYK1 antikoerper, NOK antikoerper, SuRTK106 antikoerper, 9130025L13 antikoerper, AI326477 antikoerper, Nok antikoerper, RGD1564211 antikoerper, serine/threonine/tyrosine kinase 1 antikoerper, STYK1 antikoerper, styk1 antikoerper, Styk1 antikoerper

Hintergrund: Receptor protein tyrosine kinases, like STYK1, play important roles in diverse cellular and developmental processes, such as cell proliferation, differentiation, and survival.

Molekulargewicht: 47 kDa (MW of target protein)