MARVELD3 Antikörper (Middle Region)
-
- Target Alle MARVELD3 Antikörper anzeigen
- MARVELD3 (MARVEL Domain Containing 3 (MARVELD3))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human, Maus, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser MARVELD3 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- MARVELD3 antibody was raised against the middle region of MARVELD3
- Aufreinigung
- Affinity purified
- Immunogen
- MARVELD3 antibody was raised using the middle region of MARVELD3 corresponding to a region with amino acids SYFVLAGFSASFSSGGGFGNNYYSPFEGTELEQVRQLDQQYTILRSPLIY
-
anti-MARVEL Domain Containing 3 (MARVELD3) (Middle Region) antibody
MARVELD3 Reaktivität: Human, Maus, Hund, Rind (Kuh), Meerschweinchen, Schwein, Kaninchen, Ratte WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-MARVEL Domain Containing 3 (MARVELD3) (AA 219-268) antibodyMARVELD3 Reaktivität: Human, Maus, Hund, Rind (Kuh), Meerschweinchen, Schwein, Kaninchen, Ratte, Fledermaus, Affe WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-MARVEL Domain Containing 3 (MARVELD3) (AA 25-115) antibodyMARVELD3 Reaktivität: Apple ELISA, WB Wirt: Kaninchen Polyclonal unconjugated
anti-MARVEL Domain Containing 3 (MARVELD3) (AA 1-189) antibodyMARVELD3 Reaktivität: Human ELISA, IF Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.25 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
MARVELD3 Blocking Peptide, catalog no. 33R-8948, is also available for use as a blocking control in assays to test for specificity of this MARVELD3 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of MARVELD3 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- MARVELD3 (MARVEL Domain Containing 3 (MARVELD3))
- Andere Bezeichnung
- MARVELD3 (MARVELD3 Produkte)
- Synonyme
- 1810006A16Rik antikoerper, AI642133 antikoerper, Marvd3 antikoerper, Mrvldc3 antikoerper, MARVD3 antikoerper, MRVLDC3 antikoerper, RGD1562056 antikoerper, MARVEL (membrane-associating) domain containing 3 antikoerper, MARVEL domain containing 3 antikoerper, Marveld3 antikoerper, MARVELD3 antikoerper
- Hintergrund
- MARVELD3 is involved in membrane apposition and fusion events.
- Molekulargewicht
- 46 kDa (MW of target protein)
- Pathways
- Cell-Cell Junction Organization
-
