TREML2 Antikörper (Middle Region)

Produktnummer ABIN634968

Produktdetails anti-TREML2 Antikörper

Target: TREML2 (Triggering Receptor Expressed On Myeloid Cells-Like 2 (TREML2))

Bindungsspezifität: Middle Region

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TREML2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TREML2 antibody was raised against the middle region of TREML2

Aufreinigung: Affinity purified

Immunogen: TREML2 antibody was raised using the middle region of TREML2 corresponding to a region with amino acids TGYSFTATSTTSQGPRRTMGSQTVTASPSNARDSSAGPESISTKSGDLST

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TREML2 Blocking Peptide, catalog no. 33R-9100, is also available for use as a blocking control in assays to test for specificity of this TREML2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TREML2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TREML2

Target: TREML2 (Triggering Receptor Expressed On Myeloid Cells-Like 2 (TREML2))

Andere Bezeichnung: TREML2 (TREML2 Produkte)

Synonyme: TREM-B2V1 antikoerper, C6orf76 antikoerper, TLT-2 antikoerper, TLT2 antikoerper, dJ238O23.1 antikoerper, AW049306 antikoerper, Gm750 antikoerper, Tlt2 antikoerper, triggering receptor expressed on myeloid cells like 2 antikoerper, triggering receptor expressed on myeloid cells-like 2 antikoerper, TREML2 antikoerper, Treml2 antikoerper

Hintergrund: TREML2 is a single-pass type I membrane protein, and it contains 1 Ig-like V-type (immunoglobulin-like) domain. TREML2 is a cell surface receptor that may play a role in the innate and adaptive immune response. TREML2 is located in a gene cluster on chromosome 6 with the single Ig variable (IgV) domain activating receptors TREM1 and TREM2, but it has distinct structural and functional properties.

Molekulargewicht: 41 kDa (MW of target protein)