Cyclin M2 Antikörper (Middle Region)
-
- Target Alle Cyclin M2 (CNNM2) Antikörper anzeigen
- Cyclin M2 (CNNM2)
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser Cyclin M2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- Cyclin M2 antibody was raised against the middle region of CNNM2
- Aufreinigung
- Affinity purified
- Immunogen
- Cyclin M2 antibody was raised using the middle region of CNNM2 corresponding to a region with amino acids EIIKSEILDETDLYTDNRTKKKVAHRERKQDFSAFKQTDSEMKVKISPQL
- Top Product
- Discover our top product CNNM2 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
Cyclin M2 Blocking Peptide, catalog no. 33R-2471, is also available for use as a blocking control in assays to test for specificity of this Cyclin M2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CNNM2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- Cyclin M2 (CNNM2)
- Andere Bezeichnung
- Cyclin M2 (CNNM2 Produkte)
- Synonyme
- acdp4 antikoerper, cnnm4 antikoerper, ACDP2 antikoerper, AU015877 antikoerper, AW048635 antikoerper, Acdp2 antikoerper, Clp2 antikoerper, cyclin and CBS domain divalent metal cation transport mediator 2 antikoerper, metal transporter CNNM2 antikoerper, cyclin M2 antikoerper, CNNM2 antikoerper, cnnm2 antikoerper, LOC100059801 antikoerper, Cnnm2 antikoerper
- Hintergrund
- CNNM2 is a divalent metal cation transporter. CNNM2 mediates transport of divalent metal cations in an order of Mg2+ > Co2+ > Mn2+ > Sr2+ > Ba2+ > Cu2+ > Fe2+.
- Molekulargewicht
- 96 kDa (MW of target protein)
-