PARL Antikörper (N-Term)
-
- Target Alle PARL Antikörper anzeigen
- PARL (Presenilin Associated, Rhomboid-Like (PARL))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human, Maus, Ratte, Hund
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser PARL Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB), Immunohistochemistry (IHC)
- Spezifität
- PARL antibody was raised against the N terminal of PARL
- Aufreinigung
- Affinity purified
- Immunogen
- PARL antibody was raised using the N terminal of PARL corresponding to a region with amino acids SLIKPLFFTVGFTGCAFGSAAIWQYESLKSRVQSYFDGIKADWLDSIRPQ
- Top Product
- Discover our top product PARL Primärantikörper
-
anti-Presenilin Associated, Rhomboid-Like (PARL) (N-Term) antibody
PARL Reaktivität: Human, Maus, Ratte, Hund, Schwein, Kaninchen, Pferd, Rind (Kuh), Meerschweinchen WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Presenilin Associated, Rhomboid-Like (PARL) (AA 1-170) antibodyPARL Reaktivität: Human WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Presenilin Associated, Rhomboid-Like (PARL) (AA 112-167) antibodyPARL Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 8C4B2 unconjugated
anti-Presenilin Associated, Rhomboid-Like (PARL) (AA 97-146) antibodyPARL Reaktivität: Human, Maus, Ratte, Hund, Schwein, Kaninchen, Pferd, Fledermaus, Affe WB, IHC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Presenilin Associated, Rhomboid-Like (PARL) (AA 1-170) antibodyPARL Reaktivität: Human ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Presenilin Associated, Rhomboid-Like (PARL) (AA 2-100) antibodyPARL Reaktivität: Human ELISA Wirt: Maus Monoclonal 4F4 unconjugated
anti-Presenilin Associated, Rhomboid-Like (PARL) (N-Term) antibodyPARL Reaktivität: Human, Maus, Ratte WB, IF, EIA Wirt: Kaninchen Polyclonal unconjugated
anti-Presenilin Associated, Rhomboid-Like (PARL) antibodyPARL Reaktivität: Human, Maus, Ratte, Hund WB, ELISA, IHC Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 0.5 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
PARL Blocking Peptide, catalog no. 33R-8594, is also available for use as a blocking control in assays to test for specificity of this PARL antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of PARL antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- PARL (Presenilin Associated, Rhomboid-Like (PARL))
- Andere Bezeichnung
- PARL (PARL Produkte)
- Synonyme
- PSARL antikoerper, PSARL1 antikoerper, PSENIP2 antikoerper, RHBDS1 antikoerper, D16Ertd607e antikoerper, PRO2207 antikoerper, Psarl antikoerper, parl antikoerper, zgc:112986 antikoerper, presenilin associated rhomboid like antikoerper, presenilin associated, rhomboid-like antikoerper, presenilin associated, rhomboid-like a antikoerper, PARL antikoerper, Parl antikoerper, parla antikoerper
- Hintergrund
- PARL is a mitochondrial integral membrane protein. Following proteolytic processing of this protein, a small peptide (P-beta) is formed and translocated to the nucleus. PARL may be involved in signal transduction via regulated intramembrane proteolysis of membrane-tethered precursor proteins. Variation in its gene has been associated with increased risk for type 2 diabetes.
- Molekulargewicht
- 36 kDa (MW of target protein)
- Pathways
- Autophagie
-
