SLC25A36 Antikörper (N-Term)

Produktnummer ABIN634972

Produktdetails anti-SLC25A36 Antikörper

Target: SLC25A36 (Solute Carrier Family 25, Member 36 (SLC25A36))

Bindungsspezifität: N-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser SLC25A36 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: SLC25 A36 antibody was raised against the N terminal of SLC25 36

Aufreinigung: Affinity purified

Immunogen: SLC25 A36 antibody was raised using the N terminal of SLC25 36 corresponding to a region with amino acids SSSVTLYISEVQLNTMAGASVNRVVSPGPLHCLKVILEKEGPRSLFRGLG

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

SLC25A36 Blocking Peptide, catalog no. 33R-8854, is also available for use as a blocking control in assays to test for specificity of this SLC25A36 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC20 36 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu SLC25A36

Target: SLC25A36 (Solute Carrier Family 25, Member 36 (SLC25A36))

Andere Bezeichnung: SLC25A36 (SLC25A36 Produkte)

Synonyme: MGC131068 antikoerper, slc25a36b antikoerper, DKFZp459O044 antikoerper, slc25a36 antikoerper, slc25a36a antikoerper, PNC2 antikoerper, C330005L02Rik antikoerper, solute carrier family 25 member 36 antikoerper, solute carrier family 25 (pyrimidine nucleotide carrier), member 36 L homeolog antikoerper, solute carrier family 25 (pyrimidine nucleotide carrier), member 36 S homeolog antikoerper, solute carrier family 25, member 36 antikoerper, SLC25A36 antikoerper, slc25a36.L antikoerper, slc25a36.S antikoerper, Slc25a36 antikoerper

Hintergrund: SLC25A36 belongs to the mitochondrial carrier family. It contains 3 Solcar repeats. SLC25A36 is a multi-pass membrane protein. The function of the SLC25A36 protein remains unknown.

Molekulargewicht: 34 kDa (MW of target protein)