CKLF Antikörper (N-Term)
-
- Target Alle CKLF Antikörper anzeigen
- CKLF (Chemokine-Like Factor (CKLF))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser CKLF Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- CKLF antibody was raised against the N terminal of CKLF
- Aufreinigung
- Affinity purified
- Immunogen
- CKLF antibody was raised using the N terminal of CKLF corresponding to a region with amino acids MDNVQPKIKHRPFCFSVKGHVKMLRLALTVTSMTFFIIAQAPEPYIVITG
- Top Product
- Discover our top product CKLF Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
CKLF Blocking Peptide, catalog no. 33R-5854, is also available for use as a blocking control in assays to test for specificity of this CKLF antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of CKLF antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- CKLF (Chemokine-Like Factor (CKLF))
- Andere Bezeichnung
- CKLF (CKLF Produkte)
- Hintergrund
- CKLF is a cytokine. This gene is one of several chemokine-like factor genes located in a cluster on chromosome 16. CKLF is a potent chemoattractant for neutrophils, monocytes and lymphocytes. It also can stimulate the proliferation of skeletal muscle cells. This protein may play important roles in inflammation and in the regeneration of skeletal muscle.
- Molekulargewicht
- 13 kDa (MW of target protein)
-