ATG9A Antikörper
-
- Target Alle ATG9A Antikörper anzeigen
- ATG9A (ATG9 Autophagy Related 9 Homolog A (S. Cerevisiae) (ATG9A))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser ATG9A Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- ATG9 A antibody was raised using a synthetic peptide corresponding to a region with amino acids VASALRSFSPLQPGQAPTGRAHSTMTGSGVDARTASSGSSVWEGQLQSLV
- Top Product
- Discover our top product ATG9A Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
ATG9A Blocking Peptide, catalog no. 33R-9437, is also available for use as a blocking control in assays to test for specificity of this ATG9A antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ATG0 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- ATG9A (ATG9 Autophagy Related 9 Homolog A (S. Cerevisiae) (ATG9A))
- Andere Bezeichnung
- ATG9A (ATG9A Produkte)
- Synonyme
- ATG9 antikoerper, ATG9A antikoerper, zgc:158700 antikoerper, APG9L1 antikoerper, DKFZp459N117 antikoerper, MGD3208 antikoerper, mATG9 antikoerper, AU019532 antikoerper, Apg9l1 antikoerper, Atg9 antikoerper, Atg9l1 antikoerper, RGD1310450 antikoerper, autophagy related 9A antikoerper, ATG9 autophagy related 9 homolog A (S. cerevisiae) antikoerper, ATG9A antikoerper, atg9a antikoerper, Atg9a antikoerper
- Hintergrund
- ATG9A belongs to the ATG9 family. It plays a role in autophagy.
- Molekulargewicht
- 94 kDa (MW of target protein)
-