VSIG8 Antikörper (N-Term)

Produktnummer ABIN634989

Produktdetails anti-VSIG8 Antikörper

Target: VSIG8 (V-Set and Immunoglobulin Domain Containing 8 (VSIG8))

Bindungsspezifität: N-Term

Reaktivität: Maus, Human, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser VSIG8 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: VSIG8 antibody was raised against the N terminal of VSIG8

Aufreinigung: Affinity purified

Immunogen: VSIG8 antibody was raised using the N terminal of VSIG8 corresponding to a region with amino acids HRENVFLSYQDKRINHGSLPHLQQRVRFAASDPSQYDASINLMNLQVSDT

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

VSIG8 Blocking Peptide, catalog no. 33R-3838, is also available for use as a blocking control in assays to test for specificity of this VSIG8 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of VSIG8 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu VSIG8

Target: VSIG8 (V-Set and Immunoglobulin Domain Containing 8 (VSIG8))

Andere Bezeichnung: VSIG8 (VSIG8 Produkte)

Synonyme: A030011M19 antikoerper, EG240916 antikoerper, RGD1562464 antikoerper, zgc:110326 antikoerper, V-set and immunoglobulin domain containing 8 antikoerper, V-set and immunoglobulin domain-containing protein 8 antikoerper, V-set and immunoglobulin domain containing 8a antikoerper, Vsig8 antikoerper, VSIG8 antikoerper, LOC100403027 antikoerper, vsig8a antikoerper

Hintergrund: VSIG8 contains 2 Ig-like V-type (immunoglobulin-like) domains. VSIG8 is single-pass type I membrane protein. The function of the VSIG8 protein remains unknown.

Molekulargewicht: 44 kDa (MW of target protein)