ALG11 Antikörper (C-Term)

Produktnummer ABIN634990

Produktdetails anti-ALG11 Antikörper

Target: ALG11 (Asparagine-Linked Glycosylation 11, alpha-1,2-Mannosyltransferase Homolog (Yeast) (ALG11))

Bindungsspezifität: C-Term

Reaktivität: Human, Maus, Ratte

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser ALG11 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB), Immunohistochemistry (IHC)

Spezifität: ALG11 antibody was raised against the C terminal of ALG11

Aufreinigung: Affinity purified

Immunogen: ALG11 antibody was raised using the C terminal of ALG11 corresponding to a region with amino acids LHTMWNEHFGIGVVECMAAGTIILAHNSGGPKLDIVIPHEGDITGFLAES

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL, IHC: 4-8 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

ALG11 Blocking Peptide, catalog no. 33R-5030, is also available for use as a blocking control in assays to test for specificity of this ALG11 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of ALG11 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu ALG11

Target: ALG11 (Asparagine-Linked Glycosylation 11, alpha-1,2-Mannosyltransferase Homolog (Yeast) (ALG11))

Andere Bezeichnung: ALG11 (ALG11 Produkte)

Synonyme: UTP14C antikoerper, CDG1P antikoerper, GT8 antikoerper, RGD1564725 antikoerper, AI849156 antikoerper, AW492253 antikoerper, B230397C21 antikoerper, si:dkey-1h24.5 antikoerper, wu:fj04e04 antikoerper, asparagine-linked glycosylation 11, alpha-1,2-mannosyltransferase antikoerper, ALG11, alpha-1,2-mannosyltransferase antikoerper, ALG11, alpha-1,2-mannosyltransferase L homeolog antikoerper, asparagine-linked glycosylation 11 (alpha-1,2-mannosyltransferase) antikoerper, alg11 antikoerper, ALG11 antikoerper, alg11.L antikoerper, Alg11 antikoerper

Hintergrund: ALG11 is a GDP-Man:Man3GlcNAc2-PP-dolichol-alpha1,2-mannosyltransferase which is localized to the cytosolic side of the endoplasmic reticulum (ER) and catalyzes the transfer of the fourth and fifth mannose residue from GDP-mannose (GDP-Man) to Man3GlcNAc2-PP-dolichol and Man4GlcNAc2-PP-dolichol resulting in the production of Man5GlcNAc2-PP-dolichol. Mutations in this gene are associated with congenital disorder of glycosylation type Ip (CDGIP).

Molekulargewicht: 56 kDa (MW of target protein)

Pathways: SARS-CoV-2 Protein Interaktom