C14orf180 Antikörper (Middle Region)
-
- Target Alle C14orf180 Produkte
- C14orf180 (Chromosome 14 Open Reading Frame 180 (C14orf180))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser C14orf180 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- C14 ORF180 antibody was raised against the middle region of C14 rf180
- Aufreinigung
- Affinity purified
- Immunogen
- C14 ORF180 antibody was raised using the middle region of C14 rf180 corresponding to a region with amino acids PPAVTVHYIADKNATATVRVPGRPRPHGGSLLLQLCVCVLLVLALGLYCG
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
C14ORF180 Blocking Peptide, catalog no. 33R-7243, is also available for use as a blocking control in assays to test for specificity of this C14ORF180 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF180 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- C14orf180 (Chromosome 14 Open Reading Frame 180 (C14orf180))
- Andere Bezeichnung
- C14ORF180 (C14orf180 Produkte)
- Hintergrund
- C14orf180 is a multi-pass membrane protein. The function of the C14orf180 protein is not known.
- Molekulargewicht
- 18 kDa (MW of target protein)
-