TMEM138 Antikörper (N-Term)

Produktnummer ABIN635004

Produktdetails anti-TMEM138 Antikörper

Target: TMEM138 (Transmembrane Protein 138 (TMEM138))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TMEM138 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TMEM138 antibody was raised against the N terminal of TMEM138

Aufreinigung: Affinity purified

Immunogen: TMEM138 antibody was raised using the N terminal of TMEM138 corresponding to a region with amino acids MLQTSNYSLVLSLQFLLLSYDLFVNSFSELLQKTPVIQLVLFIIQDIAVL

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TMEM138 Blocking Peptide, catalog no. 33R-6207, is also available for use as a blocking control in assays to test for specificity of this TMEM138 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM138 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TMEM138

Target: TMEM138 (Transmembrane Protein 138 (TMEM138))

Andere Bezeichnung: TMEM138 (TMEM138 Produkte)

Synonyme: MGC79801 antikoerper, 1700113I01Rik antikoerper, 2900055D14Rik antikoerper, transmembrane protein 138 antikoerper, TMEM138 antikoerper, tmem138 antikoerper, Tsp_00664 antikoerper, Tmem138 antikoerper

Hintergrund: TMEM138 is a multi-pass membrane protein.It belongs to the TMEM138 family. The function of the TMEM138 protein remains unknown.

Molekulargewicht: 19 kDa (MW of target protein)