TMEM195 Antikörper (Middle Region)
-
- Target Alle TMEM195 Antikörper anzeigen
- TMEM195 (Transmembrane Protein 195 (TMEM195))
-
Bindungsspezifität
- Middle Region
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser TMEM195 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- TMEM195 antibody was raised against the middle region of TMEM195
- Aufreinigung
- Affinity purified
- Immunogen
- TMEM195 antibody was raised using the middle region of TMEM195 corresponding to a region with amino acids AGHQTHHSSEDYNLSTALRQSVLQIYTSWIFYSPLALFIPPSVYAVHLQF
- Top Product
- Discover our top product TMEM195 Primärantikörper
-
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
TMEM195 Blocking Peptide, catalog no. 33R-1200, is also available for use as a blocking control in assays to test for specificity of this TMEM195 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TMEM195 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- TMEM195 (Transmembrane Protein 195 (TMEM195))
- Andere Bezeichnung
- TMEM195 (TMEM195 Produkte)
- Synonyme
- TMEM195 antikoerper, A530016O06Rik antikoerper, AI790538 antikoerper, Tmem195 antikoerper, RGD1312038 antikoerper, alkylglycerol monooxygenase antikoerper, AGMO antikoerper, Agmo antikoerper
- Hintergrund
- TMEM195 belongs to the TMEM195 family.It is a multi-pass membrane protein. The function of the TMEM195 protein remains.
- Molekulargewicht
- 51 kDa (MW of target protein)
-