TM7SF2 Antikörper (N-Term)

Produktnummer ABIN635009

Produktdetails anti-TM7SF2 Antikörper

Target: TM7SF2 (Transmembrane 7 Superfamily Member 2 (TM7SF2))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser TM7SF2 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: TM7 SF2 antibody was raised against the N terminal of TM7 F2

Aufreinigung: Affinity purified

Immunogen: TM7 SF2 antibody was raised using the N terminal of TM7 F2 corresponding to a region with amino acids LAARSGPARLLGPPASLPGLEVLWSPRALLLWLAWLGLQAALYLLPARKV

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

TM7SF2 Blocking Peptide, catalog no. 33R-4757, is also available for use as a blocking control in assays to test for specificity of this TM7SF2 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of TM0 F2 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu TM7SF2

Target: TM7SF2 (Transmembrane 7 Superfamily Member 2 (TM7SF2))

Andere Bezeichnung: TM7SF2 (TM7SF2 Produkte)

Synonyme: 3110041O18Rik antikoerper, ANG1 antikoerper, C14SR antikoerper, Dhcr14 antikoerper, DHCR14A antikoerper, NET47 antikoerper, zgc:103611 antikoerper, tm7sf2 antikoerper, transmembrane 7 superfamily member 2 antikoerper, transmembrane 7 superfamily member 2 L homeolog antikoerper, TM7SF2 antikoerper, Tm7sf2 antikoerper, tm7sf2 antikoerper, tm7sf2.L antikoerper

Hintergrund: TM7SF2 is involved in the conversion of lanosterol to cholesterol.

Molekulargewicht: 46 kDa (MW of target protein)