SLC16A12 Antikörper
-
- Target Alle SLC16A12 Antikörper anzeigen
- SLC16A12 (Solute Carrier Family 16, Member 12 (Monocarboxylic Acid Transporter 12) (SLC16A12))
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser SLC16A12 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Aufreinigung
- Affinity purified
- Immunogen
- SLC16 A12 antibody was raised using a synthetic peptide corresponding to a region with amino acids WMIVAGCFLVTICTRAVTRCISIFFVEFQTYFTQDYAQTAWIHSIVDCVT
- Top Product
- Discover our top product SLC16A12 Primärantikörper
-
-
- Applikationshinweise
-
WB: 0.5 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
SLC16A12 Blocking Peptide, catalog no. 33R-9979, is also available for use as a blocking control in assays to test for specificity of this SLC16A12 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of SLC10 12 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
- Avoid repeated freeze/thaw cycles.
- Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- SLC16A12 (Solute Carrier Family 16, Member 12 (Monocarboxylic Acid Transporter 12) (SLC16A12))
- Andere Bezeichnung
- SLC16A12 (SLC16A12 Produkte)
- Synonyme
- CJMG antikoerper, MCT12 antikoerper, 3230401A21 antikoerper, AW210596 antikoerper, RGD1311468 antikoerper, slc16a12 antikoerper, MGC76256 antikoerper, im:7140871 antikoerper, wu:fc44b08 antikoerper, zgc:110441 antikoerper, solute carrier family 16 member 12 antikoerper, solute carrier family 16 (monocarboxylic acid transporters), member 12 antikoerper, solute carrier family 16, member 12 antikoerper, solute carrier family 16 member 12 S homeolog antikoerper, solute carrier family 16, member 12b antikoerper, SLC16A12 antikoerper, Slc16a12 antikoerper, slc16a12 antikoerper, slc16a12.S antikoerper, slc16a12b antikoerper
- Hintergrund
- As a proton-linked monocarboxylate transporter, SLC16A12 catalyzes the rapid transport across the plasma membrane of many monocarboxylates.
- Molekulargewicht
- 53 kDa (MW of target protein)
-