HSD3B2 Antikörper (N-Term)
-
- Target Alle HSD3B2 Antikörper anzeigen
- HSD3B2 (Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 2 (HSD3B2))
-
Bindungsspezifität
- N-Term
-
Reaktivität
- Human
-
Wirt
- Kaninchen
-
Klonalität
- Polyklonal
-
Konjugat
- Dieser HSD3B2 Antikörper ist unkonjugiert
-
Applikation
- Western Blotting (WB)
- Spezifität
- HSD3 B2 antibody was raised against the N terminal of HSD3 2
- Aufreinigung
- Affinity purified
- Immunogen
- HSD3 B2 antibody was raised using the N terminal of HSD3 2 corresponding to a region with amino acids GWSCLVTGAGGLLGQRIVRLLVEEKELKEIRALDKAFRPELREEFSKLQN
- Top Product
- Discover our top product HSD3B2 Primärantikörper
-
anti-Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 2 (HSD3B2) antibody
HSD3B2 Reaktivität: Human WB, IF, ICC, IHC (p) Wirt: Kaninchen Polyclonal unconjugated
anti-Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 2 (HSD3B2) (AA 33-122) antibodyHSD3B2 Reaktivität: Human WB, ELISA Wirt: Maus Monoclonal 1E8 unconjugated
anti-Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 2 (HSD3B2) antibodyHSD3B2 Reaktivität: Human, Ratte WB, IHC, ELISA, IF, ICC Wirt: Kaninchen Polyclonal unconjugated
anti-Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 2 (HSD3B2) antibodyHSD3B2 Reaktivität: Human, Maus WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 2 (HSD3B2) (AA 1-372) antibodyHSD3B2 Reaktivität: Human WB Wirt: Kaninchen Polyclonal unconjugated
anti-Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 2 (HSD3B2) (AA 1-287) antibodyHSD3B2 Reaktivität: Human WB, IF Wirt: Kaninchen Polyclonal unconjugated
anti-Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 2 (HSD3B2) (N-Term) antibodyHSD3B2 Reaktivität: Human, Maus, Ratte, Rind (Kuh), Hund, Ziege, Meerschweinchen, Pferd, Schaf WB, IHC Wirt: Kaninchen Polyclonal unconjugated
anti-Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 2 (HSD3B2) antibodyHSD3B2 Reaktivität: Human, Maus WB, ELISA Wirt: Kaninchen Polyclonal unconjugated
anti-Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 2 (HSD3B2) (N-Term) antibodyHSD3B2 Reaktivität: Human, Ratte, Affe WB Wirt: Kaninchen Polyclonal unconjugated
-
- Applikationshinweise
-
WB: 1 µg/mL
Optimal conditions should be determined by the investigator. - Kommentare
-
HSD3B2 Blocking Peptide, catalog no. 33R-3671, is also available for use as a blocking control in assays to test for specificity of this HSD3B2 antibody
- Beschränkungen
- Nur für Forschungszwecke einsetzbar
-
- Format
- Lyophilized
- Rekonstitution
- Lyophilized powder. Add distilled water for a 1 mg/mL concentration of HSD0 2 antibody in PBS
- Konzentration
- Lot specific
- Buffer
- PBS
- Handhabung
-
Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use. - Lagerung
- 4 °C/-20 °C
- Informationen zur Lagerung
- Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.
-
- Target
- HSD3B2 (Hydroxy-delta-5-Steroid Dehydrogenase, 3 beta- and Steroid delta-Isomerase 2 (HSD3B2))
- Andere Bezeichnung
- HSD3B2 (HSD3B2 Produkte)
- Synonyme
- HSD3B antikoerper, HSDB antikoerper, SDR11E2 antikoerper, Hsd3b1 antikoerper, 3b-HSD antikoerper, HSD3B1 antikoerper, hydroxy-delta-5-steroid dehydrogenase, 3 beta- and steroid delta-isomerase 2 antikoerper, HSD3B2 antikoerper, Hsd3b2 antikoerper
- Hintergrund
- 3-beta-HSD is a bifunctional enzyme, that catalyzes the oxidative conversion of Delta(5)-ene-3-beta-hydroxy steroid, and the oxidative conversion of ketosteroids. The 3-beta-HSD enzymatic system plays a crucial role in the biosynthesis of all classes of hormonal steroids.
- Molekulargewicht
- 42 kDa (MW of target protein)
- Pathways
- Metabolism of Steroid Hormones and Vitamin D, Steroid Hormone Biosynthesis
-
