C14orf180 Antikörper (N-Term)

Produktnummer ABIN635016

Produktdetails anti-C14orf180 Antikörper

Target: C14orf180 (Chromosome 14 Open Reading Frame 180 (C14orf180))

Bindungsspezifität: N-Term

Reaktivität: Human

Wirt: Kaninchen

Klonalität: Polyklonal

Konjugat: Dieser C14orf180 Antikörper ist unkonjugiert

Applikation: Western Blotting (WB)

Spezifität: C14 ORF180 antibody was raised against the N terminal Of C14 rf180

Aufreinigung: Affinity purified

Immunogen: C14 ORF180 antibody was raised using the N terminal Of C14 rf180 corresponding to a region with amino acids EDNRKCPPSILKRSRPEHHRPEAKPQRTSRRVWFREPPAVTVHYIADKNA

Anwendungsinformationen

Applikationshinweise: WB: 1 µg/mL
Optimal conditions should be determined by the investigator.

Kommentare:

C14ORF180 Blocking Peptide, catalog no. 33R-2321, is also available for use as a blocking control in assays to test for specificity of this C14ORF180 antibody

Beschränkungen: Nur für Forschungszwecke einsetzbar

Handhabung

Format: Lyophilized

Rekonstitution: Lyophilized powder. Add distilled water for a 1 mg/mL concentration of C10 RF180 antibody in PBS

Konzentration: Lot specific

Buffer: PBS

Handhabung: Avoid repeated freeze/thaw cycles.
Dilute only prior to immediate use.

Lagerung: 4 °C/-20 °C

Informationen zur Lagerung: Store at 2-8 °C for short periods. For longer periods of storage, store at -20 °C.

Details zu C14orf180

Target: C14orf180 (Chromosome 14 Open Reading Frame 180 (C14orf180))

Andere Bezeichnung: C14ORF180 (C14orf180 Produkte)

Synonyme: C14orf77 antikoerper, NRAC antikoerper, Nrac antikoerper, C21H14orf180 antikoerper, chromosome 14 open reading frame 180 antikoerper, RIKEN cDNA A530016L24 gene antikoerper, chromosome 21 open reading frame, human C14orf180 antikoerper, C14orf180 antikoerper, A530016L24Rik antikoerper, C21H14orf180 antikoerper

Hintergrund: C14orf180 is a multi-pass membrane protein. The function of the C14orf180 protein is not known.

Molekulargewicht: 18 kDa (MW of target protein)